DPCstruct | MC50256
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 196 ± 30 aa |
| Standard deviation of domain lengths | 29.75 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 80.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 26.58 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF21381 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A182JTW3 | 47-261 | RRKLQFFFMNPIEKWEAKRRFPYKFVVQVIKIVLVTLQLCLFAHSRYTHVNYTWDNTVTFSHLFLRGWDITMEVNNYPPETGPLSVY… |
| A0A5E4CE18 | 5-177 | LKFFFMNPCEKFWARGRKPWKLAIQILKIAMVTIQLVLFGLSNQMVVAFKEENTIAFKHLFLKGYMDRMDDTYAVYTQNDVYDQIVF… |
| A0A6A5D6Y3 | 190-397 | None |
| V5BUG1 | 2-228 | None |
| A0A822DDH9 | 59-217 | None |
| A0A1I8FI12 | 33-200 | None |
| A0A7S3LXR1 | 33-241 | None |
| A0A183TKP8 | 77-295 | None |
| A0A183MG79 | 190-337 | None |
| A0A2H2JK76 | 33-197 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.