DPCstruct | MC50246
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 80 ± 7 aa |
| Standard deviation of domain lengths | 7.23 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 75.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.87 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 42.14 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A517Y2Q4 | 1-70 | MHKKKKPGLSGKDAADDIPSWAEGTRPLATETGRDFAKRLLDDKYGAGNYPTGPGSEFSKIKKWGDRAFE |
| A0A7X0AXL4 | 208-278 | NEFKEPIPRLSGKEGAKDPPSWAEGFRPKIGENAESFARRLMNDRYGPGNWKDGPTSPYSQIKKWADRSFR |
| A0A0H2MQA1 | 1-84 | None |
| A0A6M0G4C8 | 85-164 | None |
| A0A017SZW7 | 285-363 | None |
| A0A6M1LQF5 | 134-223 | None |
| A0A1Q2YVT3 | 224-313 | None |
| A0A7X5L7Y3 | 30-112 | None |
| A0A2V2E5T1 | 132-201 | None |
| A0A2V4E5W0 | 195-278 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.