DPCstruct | MC5024
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 87 ± 7 aa |
| Standard deviation of domain lengths | 6.52 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 91.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 44.63 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0310 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A191TID5 | 67-155 | DGEKSWRNRDTEFADFRCTKKELVAMWDEGWNCLLDTLKNLHSEDLGKEITIRTEPLKVYDAILRQLMHYSYHVGQIVLLGKILKDA… |
| A4IL05 | 1-78 | MYGKIEAYWEKGWSAFFQTLNELQATDLLRTVTIRVKPHSVIEAIERQMYYYSYHIGQIVYIAKQLNADHWKTLTIPR |
| A0A523IHD8 | 3-92 | None |
| E7REX4 | 11-100 | None |
| A0A090WJQ9 | 11-100 | None |
| A0A837GFG8 | 2-79 | None |
| A0A4U1CF81 | 55-155 | None |
| A0A2V7Y546 | 100-184 | None |
| A0A7W1CDD9 | 32-109 | None |
| A0A4Y8M983 | 31-119 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.