DPCstruct | MC50239
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 78 ± 12 aa |
| Standard deviation of domain lengths | 12.16 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 85.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 34.21 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3G6TBW1 | 17-90 | TAQTAPSIQWQRAYGGSESDQLKSIQSTTDGGYIFAGSTFSKDGDITYNNGKRNAWVIKADPQGGIQWQKRLVG |
| A0A7T9DS37 | 58-127 | NIQWQNTIGGNNSDYLTSIQQTTDGGYILGGYSRSSISGDKTEDNQGPDDYWVVKLDPTGNIQWQNTIGG |
| A0A1V6B6I8 | 4-77 | None |
| A0A1T5MQF9 | 270-329 | None |
| A0A523T3Q5 | 43-124 | None |
| A0A0B5KXE4 | 20-89 | None |
| A0A359C7E3 | 11-64 | None |
| A0A660ZI86 | 17-82 | None |
| A0A6V6YRM8 | 61-152 | None |
| A0A2N5YPS7 | 10-103 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.