DPCstruct | MC50236
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 66 ± 15 aa |
| Standard deviation of domain lengths | 14.85 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 81.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 35.29 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K1Q643 | 5-72 | HRLVSTDFSKRKYCVVCQSMRNKTAGGYRVQTVFKCGVCNVPLCRSNRNCFFMFHKDIIGDLNSGFGN |
| K1QP12 | 70-127 | HVAERLHAKRRRVCQHCRMTGVTTSSGHGVETSWNCVTCDVALCVNNRNCWNTFHDKL |
| A0A210Q3J1 | 30-85 | None |
| A0A210Q3E7 | 43-115 | None |
| K1PRT1 | 173-233 | None |
| K1PK33 | 43-97 | None |
| K1PH67 | 1-60 | None |
| A0A0M9A714 | 36-140 | None |
| K1QU36 | 1-58 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.