DPCstruct | MC50235
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 94 ± 15 aa |
| Standard deviation of domain lengths | 14.90 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 75.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 26.03 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12409 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K1Q4N6 | 26-111 | VLYLNKGTDDQMEITGYRPNRMKRWGMYVGYLLTAGILPLVMYWCPHWYIKCTHTQTKLADATKVLLKDQYEQWFVAEIILVTKDG |
| A0A1Y3AZU7 | 12-94 | RINVGEEDELRLQGFTNSLWKTIIVGITIVATGGMMAILLLLRPAIRIRLTKRRCTLDKAQILVLKDKYGDEFVEQMFIMPNL |
| A0A2I4AK51 | 9-103 | None |
| A0A6G0YWW4 | 36-160 | None |
| A0A3Q2UEX7 | 7-79 | None |
| A0A3Q0J4D2 | 1-94 | None |
| A0A101MLL3 | 143-233 | None |
| A0A1I8I3W8 | 10-103 | None |
| A0A0U5FXP1 | 138-231 | None |
| A0A1Y1NM94 | 6-98 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.