DPCstruct | MC50230
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 160 ± 9 aa |
| Standard deviation of domain lengths | 9.06 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 83.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 25.75 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K1PVN7 | 3-169 | DANLPEALIGNAAFLIHYSYYRQILADELLRNRLDIDSTELLHSPVLTSFPQAADQHDLMKVLRDTYVSKSKTVKRVEMRDSEFMKN… |
| A0A7I8VFS9 | 640-795 | LPDTCIASTTYITYLSFYRELLCDQLIRDCSDVQSIELIHNPLLVTFPLAVNDPDLMDTLRRAWLNKFKQTSRNQKKDFDFMKKMFY… |
| F1L581 | 1-152 | None |
| A0A2A6BZA8 | 793-967 | None |
| A0A0H3YFE3 | 813-985 | None |
| A0A1I7WT25 | 48-208 | None |
| A0A6P8IED0 | 528-702 | None |
| W6NBK5 | 939-1096 | None |
| A0A6A4S9G1 | 499-649 | None |
| Q4SQP1 | 254-409 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.