DPCstruct | MC50225
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 148 ± 22 aa |
| Standard deviation of domain lengths | 22.22 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 77.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 29.86 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K1PSG4 | 4-180 | ALIGKTDVGVKEFGRDVEVAENPTAKLMYYLDSICYVLNIEKTERNIRKLRDYQNYRRLSDEEINNLIVLCVLFSPDVLLGKCIFPD… |
| K1R8R5 | 2-122 | YYLNCLCSVLQLNTSDSPNLHRLTQYSLHWALTAAQKRELAILCWILSPDELLNKCIFIDNNLKRLNEFYEISAVQSQLFVSSSIII… |
| K1Q296 | 3-108 | None |
| A0A1I8FV80 | 13-160 | None |
| A0A813NZV6 | 4-161 | None |
| K1PQK9 | 69-237 | None |
| A0A821TNE4 | 1-173 | None |
| A0A817IFX5 | 3-148 | None |
| A0A0C9V5B3 | 9-161 | None |
| A0A1I8HDM0 | 565-738 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.