DPCstruct | MC50223
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 102 ± 11 aa |
| Standard deviation of domain lengths | 10.92 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 81.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 36.65 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08236 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K1PN73 | 2-97 | AKKIKDTFRKTMSSYIVVCLNPFRKPDCKMGRIISTEDFKHLARKLTHHVMAKELKHCRHVEDLEVNENVKSKAKDYVKKYMGKFGS… |
| A0A1B6I2E0 | 105-197 | GRKIKDAFRLNMAGVIVHYLNAYRKPDCKFGKITNTDDFKHLARKLTHFVMLKELKHCRSVDELECNDNVKHKARDFIKKYMAKFGP… |
| A0A7R9KN82 | 2-88 | None |
| A0A7R9L2W2 | 1088-1191 | None |
| A0A034VIB9 | 212-307 | None |
| A0A183SPC9 | 294-414 | None |
| A0A0L7KVP2 | 31-136 | None |
| A0A3M0IYG1 | 1-95 | None |
| U4UHI0 | 359-477 | None |
| A0A6P4XB31 | 254-350 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.