DPCstruct | MC50221
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 82 ± 4 aa |
| Standard deviation of domain lengths | 4.27 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 83.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 54.82 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K1PXW3 | 1-82 | MNTTCLVHGRYVIYYNNRTHPPYPAGYSEYAFNDLCEVEVYGCPISGYYGKDCSLSCPQNCQEGHCHIVNGTCLGCVAGYKG |
| K1QNC2 | 35-117 | QHINCSLQGRYVIYYNERSQGVVYPRFYSKYAYNELCEMEVYGCNGTFGDDCIYPCPTNCLERRCDTDTGHCFRCVPGYKGPI |
| K1PV12 | 11-89 | None |
| K1RWK6 | 77-162 | None |
| K1RQK0 | 36-122 | None |
| K1S368 | 64-141 | None |
| K1QTK7 | 200-284 | None |
| K1QC37 | 65-138 | None |
| K1RBF4 | 43-129 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.