DPCstruct | MC50220
Metacluster Properties and Pfam Annotations
| Number of structural domains | 112 |
|---|---|
| Mean domain length (aa) | 126 ± 19 aa |
| Standard deviation of domain lengths | 19.39 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 83.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 31.98 |
| Pfam Score | 96.73 |
| Assigned Pfam label(s) | CL0063- CL0603- CL0139- CL0183 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4W2HU35 | 396-509 | KAEVRLQFRDVAGDIFRQQCKRNELVIRVQPNEAVYTKMMTKKPGMFFNPEESELDLTYGNRYKNVKLPDAYERLILDVFCGSQMHF… |
| K1PM29 | 267-396 | KAEVRIQFKDVAGDIFPAGEVKRNELVIRVQPDEAVYLKMMTKSPGMTFGCEETELDLSYKSRYKDSKLPDAYERLILDVFTGSQIH… |
| A0A5P1FFM8 | 200-347 | None |
| A0A7S2NMX0 | 6-107 | None |
| A0A7S2NS77 | 136-267 | None |
| A0A4V1XRS0 | 334-475 | None |
| K2DIM6 | 94-217 | None |
| K0ZZZ8 | 12-137 | None |
| A0A2V6PZ37 | 370-499 | None |
| A0A814Q0V0 | 520-667 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.