DPCstruct | MC5022
Metacluster Properties and Pfam Annotations
| Number of structural domains | 50 |
|---|---|
| Mean domain length (aa) | 123 ± 16 aa |
| Standard deviation of domain lengths | 16.36 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 79.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 20.18 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13954 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I5BQC3 | 1-107 | MPGNYQLSLIINDQNIIHETIIPFYSRKMGDKTVSEICISPKLRDKIGLTEKALNSTGLWHQGQCVDFSPLKGVKLSASMSESQLNM… |
| A0A828R092 | 15-141 | LVMAMPCAMAVEFNLNFLDKSMRDRIDISLLKEKGVIAPGEYFVSVAVNNNKISNGQKINWQKKGDKTIPCINDSLVDKFGLKPDIR… |
| A0A378AXE6 | 21-165 | None |
| A0A381GN70 | 40-180 | None |
| U3AF43 | 1-129 | None |
| A0A7X1KK12 | 263-392 | None |
| A0A4U9UFI6 | 6-107 | None |
| A0A4U9VHC0 | 1-107 | None |
| A0A376FF34 | 1-113 | None |
| A0A2X3DF69 | 4-114 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.