DPCstruct | MC50215
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 168 ± 26 aa |
| Standard deviation of domain lengths | 25.81 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 79.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 38.12 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A820BLP6 | 177-325 | SEYLSHAVILICDKGTNDSHLFLAALDTLISIVTDPICVLPIDIWKNVLKRLCTFIDTQLHRSPKDHTREMHSTCVATYNTLITLII… |
| K1PGE7 | 74-226 | HQASDTDSAHGLFGEAVTLICHRLLSQWKTDLNSALAAMEILAGLAKLVISPPNLLMCKCTVKWICEFIVQQCNRPAPAHSKDLHST… |
| A0A817UJ56 | 22-179 | None |
| A0A6J8DVU0 | 259-426 | None |
| A0A023FHC5 | 127-275 | None |
| A0A183W830 | 33-171 | None |
| A0A7F8RCB7 | 3-127 | None |
| A0A813SGE4 | 614-800 | None |
| A0A653C0K6 | 7-158 | None |
| A0A183KJV6 | 7-189 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.