DPCstruct | MC50213
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 333 ± 36 aa |
| Standard deviation of domain lengths | 35.69 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 79.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 16.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K1PBD1 | 2-297 | VAVLLMGVMHQLRCMAKDGICPALLDAIEANGKPYFIIPIAMLLNFIFQLPVTQHALGEDSGMLPDTRELTIQGLMMRPLPLLLYLI… |
| A0A3S1CDL6 | 326-628 | VRFYGPLVPAYLVAILMLVIAEVLISTGKGQAVTYDPPETIINFSNLHYLIGFVMVLKFLLSFSLLKRLVYTTFGLPLDDFYLLEQE… |
| A0A7J7J9Z6 | 2-312 | None |
| A0A1B7TD98 | 32-378 | None |
| A0A109FNB7 | 728-1085 | None |
| A0A482V1F6 | 843-1195 | None |
| A0A0G2ELB3 | 114-440 | None |
| A0A5D2XSY0 | 391-769 | None |
| A8Q503 | 244-569 | None |
| A0A433PB54 | 592-978 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.