DPCstruct | MC50205
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 232 ± 30 aa |
| Standard deviation of domain lengths | 29.64 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 81.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 23.03 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2A9NJ13 | 111-346 | VRIKNGWYVLINAEATTYLPTDSTTTEEGEFRPPPLVPCYFGPFDQQQKHEMKMFDTLNMSAYFKESQSVVFNAGAPVWAIDWCPIH… |
| F6U313 | 315-528 | WKSLNLTKNLREQLHSHWEFPEWIPSASKWHLLTDTEAAPYLPRELKSPLFSVQREGLPEDEALYRINRFGSLTPHGERWDVSFFTG… |
| A0A5K3EY59 | 12-232 | None |
| F2SF41 | 62-362 | None |
| A0A0B7N8S0 | 10-258 | None |
| C1N9E0 | 182-381 | None |
| A0A6A6GKG8 | 41-271 | None |
| A0A7E4S8T8 | 608-807 | None |
| A0A2J7PRQ7 | 295-567 | None |
| A0A183KPU8 | 175-387 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.