DPCstruct | MC50204
Metacluster Properties and Pfam Annotations
| Number of structural domains | 76 |
|---|---|
| Mean domain length (aa) | 179 ± 48 aa |
| Standard deviation of domain lengths | 48.39 |
| Length coefficient of variation | 0.27 |
| Mean AlphaFold2 pLDDT confidence score | 72.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 23.65 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2A9NDY2 | 1-146 | MTSNTSGPRFRPFASPNHHVTKGRYITSNDPRGYIPVYEYPLNGQWIMMDIDDGYILWTGIWKALGNSKADIVKMIDSQPDLASVIR… |
| A0A0L0HPY0 | 186-286 | GLYEATYSNVPVYEMASPNGVGVMRRRHDSWMNATHILKAAGMEKSRRTKVLEREIHQGEHEKIQGGYGKYQGTWIPLYRARELAAE… |
| A0A2H3BTG8 | 1-262 | None |
| A0A1V2LLD2 | 108-310 | None |
| Q6FJB4 | 119-256 | None |
| H2AMQ0 | 214-365 | None |
| A0A1E4SMC6 | 177-311 | None |
| G4TKQ4 | 1-235 | None |
| A0A1Y1W668 | 9-210 | None |
| A0A167T2T5 | 315-503 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.