DPCstruct | MC502
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 102 ± 6 aa |
| Standard deviation of domain lengths | 5.82 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 77.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 65.55 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3B6TZC3 | 4-106 | DDKKFGKGPRELTGAVDLISQYKLEPHHDFFCKRPLPLAISDTHYLHNVVGDTEIRKGEGMELDQLVQNAYLRDKPPSIKPFDMETL… |
| A0A453LQV6 | 15-115 | KGPRELTGAVDLISRYRLLNHHSFFCKKPLPLAISDTHYLQNVVGDTEIRKGEGMEIDQLIQNPDPREKKTAYIKPFDMETLGHAFQ… |
| A0A3B6LSP6 | 15-121 | None |
| A0A1Q3C7Z3 | 56-153 | None |
| A0A4S8JH08 | 160-266 | None |
| A0A2K1L098 | 42-141 | None |
| A0A803L866 | 55-158 | None |
| A0A0R0K5X4 | 10-107 | None |
| A0A835KG38 | 117-229 | None |
| A0A4D8Y9D9 | 17-117 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.