DPCstruct | MC50194
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 110 ± 18 aa |
| Standard deviation of domain lengths | 17.61 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 77.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 39.40 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02759 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y2G3K6 | 1-98 | MLLSTIDNIISTHTPLKRSQDSHFKAFICTALNEKHLVHWLKLIYKTRVLLERYYQPWSYAVKTGFEDALKSLEKLGNFDFDLPVDL… |
| A0A6A4VQ92 | 1-118 | MLLYRCVEAVNLSHDRVHAQMDVKLRSLICMGLNEQVLHLWLEAICSNTAVVQKWYQPWSFMSSPGWVQVKCELRVLAQFSFRLNPD… |
| A0A819MZ59 | 225-337 | None |
| A0A132ACT7 | 552-681 | None |
| A0A482V8V6 | 100-193 | None |
| A0A7R9L1J9 | 718-834 | None |
| A0A7R9KC38 | 921-1018 | None |
| A0A3Q0J2B2 | 1-103 | None |
| A0A815RDY8 | 1-81 | None |
| A0A7J6BDE3 | 73-172 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.