DPCstruct | MC5019
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 87 ± 8 aa |
| Standard deviation of domain lengths | 7.64 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 82.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.69 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 37.53 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0640 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y5MHW3 | 13-96 | NFEFTDKKHANKAIERGWNEKSIENAKQNLIKVGESINRNTGNKSTVYFVDDNQYIVIDNVTNTIVQTSDLNDKDWKVDSGIKN |
| A0A552FWM6 | 86-173 | DVTSKFEPKIEKQLDKRGWTKETVQETIDNANEIKPTKDTRHLPDGSRMDDPATAYINEDGSYVVRNDRTGDIVQVSDRNAQNWKSPF |
| A0A7Y3UAE5 | 426-520 | None |
| A0A0Z8MPL0 | 6-101 | None |
| A0A7X9BR99 | 13-108 | None |
| A0A1H9Y7K5 | 97-192 | None |
| A0A0N8RYC5 | 437-519 | None |
| A0A5D5ALV7 | 466-557 | None |
| A0A845G8Z8 | 47-146 | None |
| A0A8A3MAD6 | 99-174 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.