DPCstruct | MC50189
Metacluster Properties and Pfam Annotations
| Number of structural domains | 52 |
|---|---|
| Mean domain length (aa) | 233 ± 66 aa |
| Standard deviation of domain lengths | 66.42 |
| Length coefficient of variation | 0.29 |
| Mean AlphaFold2 pLDDT confidence score | 75.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.73 |
| Mean length-normalized TM-Score | 0.37 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 26.48 |
| Pfam Score | 80.53 |
| Assigned Pfam label(s) | PF09405- PF13821- CL0097- CL0449 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A4VCR5 | 194-429 | FRREAERQHRLERRRQLADQQRRERSRPIRVLEAEQRERALDKPIDSSNKGFAMLQMMGYKPGMAIGKQGDGRTEPIRPELNQGRAG… |
| A0A672L037 | 1-153 | MVKREKEALKKEALRKEKNAQNRQKSYKEQERESREAALQSSLSSQNKGFALLQKMGYKAGQGLGKQGAGRVEPVPLNIKTDRGGIG… |
| A0A6P5MZK4 | 22-135 | None |
| F0XWE2 | 628-836 | None |
| A0A7S0H149 | 135-325 | None |
| A0A1X2HS01 | 5-265 | None |
| B9WC37 | 35-267 | None |
| A0A7G2ESB1 | 631-828 | None |
| A0A5J4NLD6 | 1-165 | None |
| B6JXR9 | 1-229 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.