DPCstruct | MC50185
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 292 ± 44 aa |
| Standard deviation of domain lengths | 44.48 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 77.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.68 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 36.57 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0220 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A4VAL5 | 24-348 | PPRKQPEPKPAPDDDPNLNEATLGLEYRSYLEEIVKVLEEDPQFKVILDNATEQEIKSGAVADKLHVVDPSIRSRLDELKRIELERL… |
| A0A2C9KTG4 | 2-216 | VNHTVRTSLDEIKRREISRLQELARLQMQGMSAHDGVKKFEIPSYLDVRNPHSFEVKDLENLIIKTTSDLEELDKQRKEEFKEYEME… |
| A0A1D2NKG0 | 43-360 | None |
| A0A7R9KK97 | 23-347 | None |
| A0A2K6GA17 | 17-319 | None |
| E4XS77 | 17-350 | None |
| A0A6B0RSQ9 | 26-353 | None |
| A0A7R8CPY0 | 30-286 | None |
| A0A0A9YPC7 | 7-240 | None |
| A0A4U8UX50 | 34-288 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.