DPCstruct | MC50179
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 173 ± 21 aa |
| Standard deviation of domain lengths | 20.54 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 87.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 27.99 |
| Pfam Score | 90.00 |
| Assigned Pfam label(s) | PF08180- PF17804 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C2G0Y9 | 20-189 | VSIVACGAKPRVNLEEGEGGVKPTMQHEIIAKEVANLLENVSYKKVPMNDSLSNLVFNNLIKSMDQGKNYLLQSDIDEFQQYKNELS… |
| A0A379S3G6 | 10-166 | IPVLKEETQHATVSERVTSRFTRSHYRQFDLDQAFSAKIFDRYLNLLDYSHNVLLASDVEQFAKKKTVLGDELRTGKLDVFYDLYNL… |
| A0A538PMT1 | 32-194 | None |
| A0A388P6S8 | 6-171 | None |
| A0A6I1J1Y8 | 1-207 | None |
| A0A0M3CAD2 | 39-194 | None |
| A0A1G3QCV0 | 6-187 | None |
| A0A388PF56 | 2-206 | None |
| A0A5C6A0C7 | 186-372 | None |
| A0A2V2L3U2 | 16-166 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.