DPCstruct | MC50175
Metacluster Properties and Pfam Annotations
| Number of structural domains | 111 |
|---|---|
| Mean domain length (aa) | 131 ± 37 aa |
| Standard deviation of domain lengths | 36.77 |
| Length coefficient of variation | 0.28 |
| Mean AlphaFold2 pLDDT confidence score | 85.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 27.17 |
| Pfam Score | 95.25 |
| Assigned Pfam label(s) | CL0193- CL0010- PF00238 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P6SB83 | 8-133 | KLIRHWKVLRGDNVMIIRGKDKGETGVIKRVIRSQNRVIVEELVKKHIKQGQGHEGGIFTVEAPLHASNVQVTDPVTGRPCKVGVKY… |
| A0A0N0DV68 | 88-243 | HQKGQIASRYPFFAPNYEIKPWLWYPGDIVEVTSGEGVGQRGSIIAVVKYKNEILVQNINVQDVVIPASETRPEQVVQREHPISVHR… |
| A0A6J5VQX6 | 112-256 | None |
| A0A7R8X7Y3 | 644-782 | None |
| A0A1G2TGL0 | 1-69 | None |
| A0A2V1D1Q4 | 114-235 | None |
| A0A0G4KGS4 | 20-183 | None |
| A0A7J6KVM6 | 3-110 | None |
| A0A7S3PG76 | 10-124 | None |
| A0A0C2ML62 | 50-167 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.