DPCstruct | MC50174
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 142 ± 13 aa |
| Standard deviation of domain lengths | 12.68 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 68.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 43.55 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12313 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P6S0E6 | 19-153 | DDLNVRLDYFENRVAFARLLFPAEAKLAMEMADHPTSDSSGNLREVDLNETPSVRSERLHEKLRALIKTVDMGQRFSPHCSEVLDMF… |
| A0A438HBN9 | 2-120 | EIAHAETTSEFAGLSASKRSSGNLREVDLNETPIMQNQRLRSRMNALVKTVEMGRRYFPHCSQVLDKFMEDDLPDLFYLEKGTLDEQ… |
| A0A811N1C5 | 309-428 | None |
| A0A287KBR9 | 259-412 | None |
| A0A4Y7IVU7 | 1-125 | None |
| A0A4Y7IVR0 | 28-184 | None |
| A0A4Y7ISI3 | 6-143 | None |
| C0HES7 | 102-255 | None |
| T1LKM4 | 52-193 | None |
| A0A059B5E8 | 4-150 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.