DPCstruct | MC50161
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 128 ± 12 aa |
| Standard deviation of domain lengths | 11.90 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 82.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 29.73 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A1TA40 | 16-153 | ASFISQPPSISKYHGAISGSTIRSRLYDVGWYGSYPQREFVTVEGRAVRPSLTKVDDRCDKGHMFIAPRGELVDMPGPMLLDAEGEI… |
| A0A0D2EML5 | 54-169 | TLYDLGFYGGSPSQTYISNGLSSPRVSISKYDPNCDKGYTFLNYNGGSMPNPGPAILDSNSELVWKGQNFDVTTNLKVQSYMGQQYL… |
| A0A1U8QIZ4 | 1-131 | None |
| A0A2H1IL01 | 3-142 | None |
| A0A2N6NYL8 | 43-159 | None |
| G2XXF5 | 23-159 | None |
| A0A2S8BHU8 | 5-146 | None |
| A0A1L9PX29 | 1-125 | None |
| A0A4U0VDI4 | 1-138 | None |
| A0A6L5EYW8 | 150-256 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.