DPCstruct | MC50160
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 101 ± 11 aa |
| Standard deviation of domain lengths | 10.89 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 87.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 47.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A1T755 | 1-93 | MSVVCYGGSVLAVAKHVNARVKSSILYEDVATAIDGGRDAKDAGANELLGCGKNGGQMGVAANLTNPLYSTKAHKDSGAKPEGIIIK… |
| T0KX17 | 86-178 | DCGEWLVYAHGTAQAFAKHINNTVNSSVLFADIATTIDGGVGASEAQIAASLLGCGTDGGSLGVLVNTANPTYSGSTYPAGYVTNGI… |
| A0A6A6TW35 | 150-246 | None |
| A0A1J7ICF6 | 86-178 | None |
| A0A2H4STZ0 | 83-175 | None |
| G3JGF3 | 82-190 | None |
| A0A367L019 | 1-121 | None |
| A0A0A2VTS5 | 90-174 | None |
| A0A1B5L1R0 | 83-173 | None |
| A0A0A2VHB9 | 84-185 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.