DPCstruct | MC50158
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 152 ± 21 aa |
| Standard deviation of domain lengths | 21.25 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 79.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 25.83 |
| Pfam Score | 80.56 |
| Assigned Pfam label(s) | CL0192- PF05730- CL0028 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A1SPQ0 | 17-159 | WAETSVLSLPFSLDVLSTMPLCAASCLAKTSAISSMPSNNQTANLCKDVLFQQEAILCVRHMCTIMETLAAQNITNTACNVPLRDRS… |
| T0K2S5 | 12-163 | VSCLLRLTVAQSLADAPPCALKCFGQALAQPQFANKTQAQLCVDEGFNTAVSGCVQPACTVIESLSFLNISRTLCGLPEADHRNEAK… |
| A0A1W2TIM8 | 1-136 | None |
| W9JFF7 | 16-157 | None |
| G0SBE2 | 4-159 | None |
| A0A0F4GE33 | 2-186 | None |
| A0A135TZC7 | 8-153 | None |
| T0LG93 | 15-224 | None |
| W9NQ17 | 1-146 | None |
| A0A084B2F6 | 1-168 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.