DPCstruct | MC50157
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 332 ± 50 aa |
| Standard deviation of domain lengths | 50.35 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 73.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 25.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A1SKG2 | 1-335 | MDRMSPPASPDMAPREMPEAGSATASSRPAETEESGRRRESSSSLALFLSPLFELYQGTLTTKSVYPAMRAFLLSDGYAAAWGKLVA… |
| A0A167EP53 | 2-270 | SRQRARAVFLRQLLLQDTPPSQVPRLLIRRCILRNGTLEAVLLVLAATLANHVRRLLVPWLGQFVWRHALENMRFARSSPHYFLEHS… |
| F0X7U2 | 1-382 | None |
| A0A179GW05 | 48-379 | None |
| A0A545VV64 | 314-691 | None |
| A0A167P0C9 | 43-402 | None |
| A0A168BDI9 | 1-368 | None |
| A0A2C5YVC0 | 9-242 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.