DPCstruct | MC5015
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 63 ± 5 aa |
| Standard deviation of domain lengths | 5.37 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 91.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 46.34 |
| Pfam Score | 87.50 |
| Assigned Pfam label(s) | CL0178- PF00719 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D3L6T3 | 1-70 | MASRPFSVLGQTMTVAIDQPLGKAYQERAQLIYPVNCGKVTQIVGGNVEKQDAYVLGQKYRCHPGLETFR |
| A0A354K7Z9 | 2-63 | IGKTVTVTMDRPLGTYHPRHPNIYYTVNYGYVAGIMAPDGAEQDAYVLGVDVPLETFTGKVI |
| A0A1T4KNF2 | 358-424 | None |
| A0A8A7GJV9 | 3-61 | None |
| A0A650LTK5 | 4-58 | None |
| R5XTN3 | 71-130 | None |
| A0A239R874 | 290-352 | None |
| A0A1Q6SZY7 | 49-114 | None |
| A0A1G8UWK9 | 115-177 | None |
| A0A316T0E7 | 3-63 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.