DPCstruct | MC50149
Metacluster Properties and Pfam Annotations
| Number of structural domains | 281 |
|---|---|
| Mean domain length (aa) | 180 ± 31 aa |
| Standard deviation of domain lengths | 30.51 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 78.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 18.62 |
| Pfam Score | 56.42 |
| Assigned Pfam label(s) | PF08590- CL0020- CL0537- CL0192- PF01713 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5B1QTW5 | 40-213 | QPPAAEHVKIGAPETEWRVRAGDSAGTELRNRAQEAFKVMREEREKARKARVAGNRSDAQLHNRLADERRVQAEKLNKDAAEVLYRE… |
| A0A7C9AVI6 | 8-150 | LQDNAAFNFVNALEDFLWAFELRATASWLFQLAVNRGIYQHDVFRVAEGDWGADFRKLSAGAALVGLTLWLDHMQDASLEGSPESPK… |
| A0A7S2XLX6 | 311-478 | None |
| A0A7R9PXR1 | 338-526 | None |
| A0A6S7GWR7 | 383-576 | None |
| A0A6S7G597 | 765-972 | None |
| H0EHG9 | 40-250 | None |
| A0A835RT24 | 17-173 | None |
| A0A831YBM9 | 15-198 | None |
| A0A0S6XJI7 | 7-101 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.