DPCstruct | MC50148
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 315 ± 44 aa |
| Standard deviation of domain lengths | 43.74 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 81.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 24.47 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5B1QF82 | 8-332 | STIHLLPPHEHLSTDLRAIRNNGDLHVSFAWLGHGAIMHQSRAVEFLDLLQHLNATDSEFKMADNYFSLLSNIIPEVWFDQGIELGG… |
| K5VF69 | 101-353 | YCFIQDDDYLVIPEVIHALHARIQDVQCPHSIHLLPPHEHLSSTLREIRAEGLYPFHISFAWLGYGAMLYRSEVADFMDLMHLLNTS… |
| A0A819IFJ4 | 28-346 | None |
| A0A4Y9YT33 | 173-492 | None |
| A0A815N8Y6 | 143-467 | None |
| A0A261XVK6 | 209-541 | None |
| I1BK31 | 114-312 | None |
| A0A4S4MDR5 | 254-588 | None |
| A0A0L6V684 | 1-404 | None |
| A0A1Y2GM11 | 333-703 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.