DPCstruct | MC5013
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 63 ± 5 aa |
| Standard deviation of domain lengths | 5.37 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 86.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 65.33 |
| Pfam Score | 87.50 |
| Assigned Pfam label(s) | CL0016- PF01871 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q9AQU1 | 1-60 | MSKARVYADVNVLRPKEYWDYEALTVQWGEQDDYEVVRKVGRGKYSEVFEGINVNNNEKC |
| A0A391NUP1 | 9-75 | VIGPREFQDVLSEYPQGFYDYEQLRLTYSDQEIYYIYRKIGRGKYSDVFEGYNAYTDSMVVIKVGIE |
| A0A670ZS30 | 1-72 | None |
| A0A418AXL8 | 204-262 | None |
| A0A803KY72 | 64-122 | None |
| A0A024GDC4 | 175-233 | None |
| A0A7N6FAS2 | 1-72 | None |
| A0A830B2M6 | 477-535 | None |
| A0A6A3BUG8 | 1-60 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.