DPCstruct | MC50127
Metacluster Properties and Pfam Annotations
| Number of structural domains | 66 |
|---|---|
| Mean domain length (aa) | 74 ± 8 aa |
| Standard deviation of domain lengths | 7.93 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 83.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 21.85 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2S2CP96 | 2-65 | LYLRDIDGDVDIRCRACGHGGRLPLGMLVRRFGPSYPVLSIAPHYRCSQCDSRDVETRPALPDR |
| A0A3S2BX13 | 2-71 | AGWTFASLIEHDMKVTAHCLHCNHSQTLDLEALRERYGADAPAMATDLAPRMKCTACKKRAVGFSYTPDY |
| A0A1C3USA7 | 47-115 | None |
| A0A840Z6I6 | 1-79 | None |
| A0A0Q4IQV0 | 39-114 | None |
| A0A258KTG2 | 45-108 | None |
| A0A5C7NWJ1 | 10-81 | None |
| A0A245ZHL2 | 60-136 | None |
| A0A4V6QP54 | 1-96 | None |
| A0A5E7ZLZ0 | 8-71 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.