DPCstruct | MC5012
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 177 ± 13 aa |
| Standard deviation of domain lengths | 12.66 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 74.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 33.03 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0194 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H2I6F6 | 347-519 | PAIVVLLSDTEPFRLVRKIPNLGLFPNVQLHISEPSSLLNQIDWQKVVARRVLQHFFNSFFYMTDYLEWSRYLQIPIGNLPSDHSLF… |
| A0A2P6QG92 | 1-192 | MLIYVFGHWLITYMTFMSDRHDHGPTIAVIECPNVQLIKSGIRALDDFPCVSIPCNARDSQYQVLGWQQVAAKIGMQRCAASSQWLI… |
| A0A183H6I0 | 517-677 | None |
| A0A452YAU9 | 633-821 | None |
| A0A4C1UE30 | 113-298 | None |
| A0A7N2KRE7 | 499-689 | None |
| A0A817G9Q0 | 1-161 | None |
| A0A396ZZB4 | 1-184 | None |
| A0A817ENN4 | 1-164 | None |
| A0A0M3J2E2 | 154-311 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.