DPCstruct | MC50115
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 70 ± 3 aa |
| Standard deviation of domain lengths | 2.78 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 86.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 24.47 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V6XEZ1 | 1-70 | MDPADRARGFLILHESADFCDDCLGRALGITAAEARTIVASLAKSSAILRDRWTCKSCRKHALVTRAIPN |
| A0A7V3XG61 | 9-75 | DLESRLIARLRALHPFAWCDACLAVIFAVSEDEMRAAAVAAVGRHAALARERRACYACQRTTELTAL |
| A0A2V6QMT0 | 2-64 | None |
| A0A2V7DL29 | 95-165 | None |
| A0A7J3V3P2 | 4-72 | None |
| A0A1G3UM86 | 167-237 | None |
| A0A2V8F1K1 | 74-147 | None |
| A0A7V2ICV1 | 102-171 | None |
| A0A1V6B1Q2 | 1-73 | None |
| A0A2V8DB58 | 3-69 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.