DPCstruct | MC50114
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 289 ± 73 aa |
| Standard deviation of domain lengths | 72.57 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 81.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 44.17 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2I4DA53 | 1-241 | MLDVYWLLCVCIRTIEHADNTGSLFAFTPEFFLNVAMNAYSALKNYFSPANSMEELPGYEETLTQLAAILAKHFADPRIVGTDIKDS… |
| A0A0J7KWJ3 | 242-559 | AWLLKVVTLTLQTASQQGCTFSFVPDFYLETLSDLCVSLRAHMHPTAPIENIPDYQDMLRNAAEFLCDHFLDSRIVHANSKDVLILT… |
| A0A0P7VK87 | 201-498 | None |
| A0A0L7LBE9 | 50-281 | None |
| A0A182T3H1 | 191-494 | None |
| A0A7D9LSB8 | 2-174 | None |
| H2Y950 | 1-191 | None |
| A0A670K2H3 | 6-187 | None |
| A0A669QKN9 | 341-707 | None |
| F7B5D3 | 97-423 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.