DPCstruct | MC50110
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 62 ± 7 aa |
| Standard deviation of domain lengths | 7.17 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 92.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 41.10 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A495UJJ6 | 51-129 | GAACDFFVEGVATSDIVRFITQTLNYDRIYYYGNNRPLHVSIHLTDPLKHLQIMSESENGRRYPGKKAFGDQAVILAED |
| V6F143 | 1-63 | MLEVAKWVAANTPFDRLYFYGRDRPIHVSYGPENKREVFELVPTLGGKRIPRRIPIQKLSSST |
| A0A2D8J7E2 | 498-557 | None |
| A0A2T1D091 | 8-62 | None |
| A0A6N1YA19 | 59-116 | None |
| A0A0F0EBD7 | 795-850 | None |
| A0A0D6AVV2 | 112-170 | None |
| A0A0B8PIU9 | 1-60 | None |
| A0A1Y6KYS5 | 1-54 | None |
| H8Z7G5 | 171-241 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.