DPCstruct | MC5011
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 73 ± 9 aa |
| Standard deviation of domain lengths | 9.10 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 87.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 68.17 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0374 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P6QG26 | 14-86 | CIRLTPEELENFDTPDFTIYNAGQFPCNRYTHYMTSSTSVDINLASKEMVILGAMYAGKMKKGLFSLMHYLMP |
| A0A446S909 | 46-129 | RAYHSLFMHNMCIRPTEEELESFGTPDFTIYNAGKFPCNRYTHYMTSSTSVDINLGRREMVILGTQYAGEMKKGLFGVMHYLMP |
| S0E507 | 196-262 | None |
| A0A1V8V0L5 | 163-226 | None |
| A0A426Z908 | 4-77 | None |
| R5JP11 | 1-72 | None |
| A0A1D6FBT5 | 241-302 | None |
| A0A1D6FBU2 | 161-217 | None |
| A0A1D6FBT4 | 320-377 | None |
| A0A1Q9CBJ7 | 190-272 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.