DPCstruct | MC50105
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 392 ± 66 aa |
| Standard deviation of domain lengths | 65.77 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 75.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 17.42 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07793 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G8CKG8 | 10-374 | QAFESSVLNDGTISDSRPVAVSTNSASLRRWLDELKQRQPLPTALGQVVQSFELPLIRLVQRDAAALSDERHASRKLIDTVIERGLR… |
| A0A1H2V4M2 | 36-425 | PLNPIGAGQVSDWRPLLLSCWSEQRDETVVHLLNSVSVTWTVTQVNSAYMADRIMDAFLETSGLNVVLARQVARLRFFLAWRLSEEG… |
| A0A657B6I3 | 213-620 | None |
| A0A8B0U2H5 | 95-414 | None |
| A0A7W0JR49 | 122-589 | None |
| A0A2E8F4T5 | 12-347 | None |
| A0A2E8K7U3 | 451-810 | None |
| A0A6M5XSD3 | 276-627 | None |
| A0A0Q7ASQ2 | 300-801 | None |
| A0A2A5WK21 | 11-322 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.