DPCstruct | MC50104
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 78 ± 13 aa |
| Standard deviation of domain lengths | 13.28 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 83.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 34.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q6EV77 | 76-131 | LEASRHPQQRTACETCPNSVWFSSPEEVKCYCRVMYLVAWSSQAPSQITHCDGLYL |
| Q8RM83 | 23-96 | EQPMKIERSEAQSPTLSALDKARQPKITTACETCPNAIWFSSPEEVKCYCRIMHMITWSGKDSNLITMCDGKFL |
| A0A2G8E5G7 | 18-91 | None |
| A0A242MNH0 | 70-167 | None |
| A0A257QGR8 | 1-65 | None |
| A0A1V3S3F3 | 6-87 | None |
| A0A1X9U849 | 1-94 | None |
| A0A1W9K857 | 8-67 | None |
| Q00190 | 36-119 | None |
| A0A7T4UET9 | 11-112 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.