DPCstruct | MC50103
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 125 ± 10 aa |
| Standard deviation of domain lengths | 10.30 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 87.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 25.43 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V9V7N2 | 509-629 | HTQTATLGQAITIPRYSGALFARISMKQTLQGKISKTLYKSGGLSINLELRNGERRKFHFVPSMAESGFVVSPLIEDAFDLALLADG… |
| A0A1E5JLU7 | 301-423 | LKRESHVLGEQVDIPKEQLLFAEIELKPKVLGILAVILFKPQQLQITLKLNNGTTKQYRFVANMAKSTFLLSPLIEDTLEFSLLYKK… |
| A0A0S4UC66 | 280-394 | None |
| A0A1U9VIA1 | 67-182 | None |
| A0A098TMB5 | 241-372 | None |
| M6G7F9 | 1-143 | None |
| A0A7T9CLH4 | 742-878 | None |
| E1RBT6 | 647-780 | None |
| A0A378INX3 | 521-639 | None |
| A0A4R0WRH6 | 46-155 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.