DPCstruct | MC501
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 98 ± 9 aa |
| Standard deviation of domain lengths | 8.53 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 70.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 49.00 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0064 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A816NPQ0 | 73-170 | WFMPINVGITFLVGGILGWLVVKLLNPKPQLHGLIIATCASGNMGNLMIILVPAICDEEGSPFGNRSVCRSIGLSYASFSMALGGFY… |
| A0A2H9ZYQ6 | 1-85 | MPINIGFTFLIGGVLGWIIVKILRPARQLEGLIMANCSTGNLGNLMLMIVPAVCGEAGSTFGDKSTCSTRGLSYVSTSMAVTSFS |
| A0A287S5S0 | 1-85 | None |
| A0A0D9XGJ9 | 69-169 | None |
| A0A803MHR4 | 146-243 | None |
| A0A2K2ACY2 | 1-99 | None |
| A0A438H3M1 | 3-93 | None |
| A0A2P6QSQ3 | 3-98 | None |
| A0A6A3AF40 | 71-189 | None |
| A0A453LKU8 | 4-106 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.