DPCstruct | MC50096
Metacluster Properties and Pfam Annotations
| Number of structural domains | 54 |
|---|---|
| Mean domain length (aa) | 129 ± 20 aa |
| Standard deviation of domain lengths | 20.31 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 82.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 33.43 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0F8A1N0 | 2-135 | SKFLLHNKLRSLDSAAREEGNFLLAAQHQSAAESFRRQVWSQKETIAALTRHHLGLHRNDSCTVLPPDTWIQGGFNLCALVEVESGN… |
| A0A0D2HD26 | 2-92 | TEIEAIVSFHLGSSDFQLGDEEMWISGSYNVCVPMYFSPASKKDDVYTRIPLPYKVGERNSPGNVEEKLRCEVASYIWIQQNCPDIP… |
| A0A545VRF8 | 137-286 | None |
| A0A545UZI7 | 2-143 | None |
| A0A6A5SX16 | 17-146 | None |
| A0A2S4KRX4 | 9-153 | None |
| G3JNM0 | 671-807 | None |
| A0A168CGB5 | 4-147 | None |
| D4D6A1 | 682-820 | None |
| A0A1B8EZM3 | 43-187 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.