DPCstruct | MC50095
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 162 ± 11 aa |
| Standard deviation of domain lengths | 10.50 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 71.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 38.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0F8A106 | 1-175 | MAMADLSNEGSQRSGPLTQAPSPSSKLITGTPPRYDSPQAIFARYVKTRNAWYTAQPSGSIKTNQQYRRAMRLPLRYSKQSYNWCLD… |
| M1WIG8 | 309-453 | SSAGPSSAGPSSAGPSSDFHFAGFSSGKEKLGPEAPESIYERYRETRELWYEGNPNAQTNEAFRRAHRWPLRVTKIMRKHYTDRKYM… |
| A0A0C3CWQ7 | 120-274 | None |
| Q870E2 | 680-834 | None |
| X0M0Y9 | 1-153 | None |
| W9JDW9 | 31-185 | None |
| A0A1B8A8K1 | 1036-1191 | None |
| J5JBR4 | 41-200 | None |
| W9NBL8 | 673-833 | None |
| A0A3L6N2R6 | 315-476 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.