DPCstruct | MC50090
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 70 ± 7 aa |
| Standard deviation of domain lengths | 7.30 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 87.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 47.60 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14615 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Z0Z456 | 6-69 | QKTAADFTSYYLQQSTKEFAEDLDKIRSADDFKGDALPVLIRSLQQGTSMFSAADQKRIVDAQQ |
| A0A0F7ZPK3 | 9-73 | EGFDARFAAFYLQTATRELSEDLNQVRNAEDFKGDSVSFLVDALRQGANQFSAEDKKRILSQVQD |
| H0EL91 | 38-107 | None |
| A0A0S6XAI2 | 9-87 | None |
| A0A6A5ZS69 | 85-152 | None |
| A0A6A6U456 | 47-112 | None |
| A0A6A5X4Y1 | 100-176 | None |
| A0A194W8A1 | 11-78 | None |
| G0RIT8 | 11-69 | None |
| S0DY41 | 1-70 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.