DPCstruct | MC50088
Metacluster Properties and Pfam Annotations
| Number of structural domains | 188 |
|---|---|
| Mean domain length (aa) | 249 ± 48 aa |
| Standard deviation of domain lengths | 47.65 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 72.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 16.90 |
| Pfam Score | 81.82 |
| Assigned Pfam label(s) | CL0023- PF14214 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2I4AKQ7 | 146-304 | KREVSAQECVTRSCGLKMKNSSRSVIFVPTDDNPLKMSRPMSFLESTTPDSENIWMTSLNDKYKSRPETPEYEEMCLADFASTCRFV… |
| A0A0F7ZGW2 | 53-295 | DDGSHNKTRQFLMKVANRVFTERPLSQVEVVADLLGYRTELTNSCAWAFLNASVLYWHVFRQWPHLRQESGAAIADGSGDESIVVEE… |
| A0A819QB42 | 346-540 | None |
| A0A6S7G4M8 | 3-277 | None |
| A0A2G8LGG1 | 77-342 | None |
| A0A537J9H7 | 130-391 | None |
| A0A1Q9BVF6 | 1-279 | None |
| A0A1Q9C8C3 | 127-507 | None |
| A0A820CI65 | 69-379 | None |
| A0A820DU01 | 8-237 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.