DPCstruct | MC50082
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 106 ± 7 aa |
| Standard deviation of domain lengths | 7.40 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 77.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 32.99 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2R6ID37 | 6-106 | TMEKIRLILDGVHDGNIVILEEGLDPDEESRLIEVTMSEINPEEFTGIEIETYPRPSSDDGGLFNRLMGRESDPDNKLTVIGPANRI… |
| A0A832XHL3 | 21-134 | SSKKSLKIDFISMSKLKGDTIEAKIDIILDKVKIGHVVILDEALSPDEEAHLVTETMEGINEEFSGIEFCSLPRQSGKARMLLSRVA… |
| A0A2U3CIE9 | 1-98 | None |
| A0A2I0QL77 | 2-102 | None |
| A0A2H9LUI1 | 5-96 | None |
| A0A497HPI0 | 8-118 | None |
| A0A2R6KR69 | 11-123 | None |
| A0A2G9PIT3 | 1-113 | None |
| A0A7J4FYZ1 | 2-95 | None |
| A0A2I0Q6A7 | 6-116 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.