DPCstruct | MC5008
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 98 ± 18 aa |
| Standard deviation of domain lengths | 17.74 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 66.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 44.28 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05498 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J9GZL9 | 4-70 | CMAEDEFDMDSEISRRILQTTQYISYGALQRNTVPCSQRGASYYNCQPGAQANPYNRGCSAITRCRS |
| A0A2P6Q449 | 8-109 | VVLLVALAMVAAVESSKIHDAAWGLKQRHNNVGDMIGEETEMLLDSEAGRRQLMQGRFISYEALKKDNIPCGQRGKSYYDCNNRNQV… |
| A0A816LGG7 | 23-118 | None |
| A0A0D2R0M7 | 2-114 | None |
| A0A4U5QSY9 | 1-66 | None |
| A0A7J9FSY0 | 56-184 | None |
| A0A5N6PPJ7 | 38-164 | None |
| A0A843UHT5 | 15-136 | None |
| M4EMR1 | 3-91 | None |
| A0A426Z5V2 | 15-115 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.