DPCstruct | MC50077
Metacluster Properties and Pfam Annotations
| Number of structural domains | 63 |
|---|---|
| Mean domain length (aa) | 97 ± 16 aa |
| Standard deviation of domain lengths | 16.41 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 68.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.73 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 49.92 |
| Pfam Score | 98.67 |
| Assigned Pfam label(s) | PF08474- PF01530 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A834PEX3 | 1-117 | MLYGAGNGGLTILNYRCPIPGCDGSGHATGKFLSHRSASGCPIANRNKMRVLESGGTVEQHKAAIAATTAMKFEGVNCPTPGCDGIG… |
| A0A443SHV2 | 23-94 | TKCPTPGCNGTGHSTGLYSHHRSLSGCPRKDKITPEILAMHETILKCPTPGCNGRGHVNSNRNTHRSLSGCP |
| S4RC21 | 337-429 | None |
| A0A016TMM3 | 181-293 | None |
| A0A182JH64 | 59-177 | None |
| A0A4W4HHY5 | 119-234 | None |
| A0A564Y1T6 | 1-96 | None |
| A0A3Q0KSH2 | 219-298 | None |
| A0A7F8RR31 | 454-561 | None |
| A0A4U5UN68 | 403-492 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.