DPCstruct | MC5007
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 79 ± 3 aa |
| Standard deviation of domain lengths | 3.27 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 90.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.95 |
| Mean intra-cluster local Distance Difference Test score | 0.95 |
| Mean intra-cluster sequence similarity (%) | 69.18 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0040 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A067D615 | 355-435 | MDIVDCLFVTIFDSLNNVCKKELEAVAKQYPFEPLKYKPKTLRLTFEEGVQMLKDAGVEIDPLGDLNTESERKLGQLVLEK |
| A0A2P6Q1T8 | 1-70 | MDIVSRLFVTMFDYLNKNCEKELEAYLPETLRLTFAEGVQMLKEAGVEVDPTGDLNTEAERKLGQLVLEK |
| A0A3L6TAR0 | 627-700 | None |
| D7LWQ0 | 1-81 | None |
| A0A816PDN6 | 47-127 | None |
| A0A5A7PJ11 | 893-973 | None |
| A0A4U6VQH7 | 49-128 | None |
| A0A803M5I9 | 310-389 | None |
| A0A5E4GD38 | 11-91 | None |
| A0A5J5AGC1 | 347-427 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.